PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC040670.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 60aa    MW: 6731.54 Da    PI: 8.5185
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC040670.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.24.7e-29458358
   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                  ++rY eC++NhAas+Ggh vDGC Ef p  g eg+  a++Ca CgCHRnFHR+ ve
  EcC040670.10  4 RIRYAECQRNHAASTGGHQVDGCTEFRPR-GVEGSDLAFTCATCGCHRNFHRKVVE 58
                  79**************************8.9999*******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-15258IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.4E-27557IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.7E-23655IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.447756IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
RMPRIRYAEC QRNHAASTGG HQVDGCTEFR PRGVEGSDLA FTCATCGCHR NFHRKVVENP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559051.17e-23PREDICTED: mini zinc finger protein 2
SwissprotQ9CA512e-21MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A059ADI11e-39A0A059ADI1_EUCGR; Uncharacterized protein
STRINGSolyc02g067330.1.17e-21(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-22mini zinc finger 1